PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g18717.2.p
Common NameBRADI_5g18717
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 818aa    MW: 87881.7 Da    PI: 5.0806
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g18717.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-19112167156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +r+  ++++eq++eL++lF k+++p++ +r+eL+++l L+ +qVk+WFqNrR++ k
  Bradi5g18717.2.p 112 KRPYVRHSSEQIQELQALFDKCPHPDEMQRAELSRRLFLDPSQVKFWFQNRRTQTK 167
                       789999**********************************************9987 PP

2START137.11.9e-433205581206
                       HHHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCS.CHHHHHHHHHCCCGGCT-TT-S.. CS
             START   1 elaeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvd.mvlallveellddkeqWdetla.. 77 
                       ela +a++elvk+a+ e+p+W+ s+        e +n++e+l +f++  +     +++ea+r+sg+v+ ++++ lve l+d + +W++ +   
  Bradi5g18717.2.p 320 ELAKSAMDELVKMAQMEDPLWTPSVslsdspakETLNYEEYLNTFSPCIGvkpagFQSEASRESGIVIsDDSVALVEALMDER-RWSNIFScm 411
                       57899*****************99999*******************99889**************998345679*********.999999999 PP

                       ..EEEEEEEECTT.......EEEEEEEEXXTTXX-SSX...EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEE CS
             START  78 ..kaetlevissg.......galqlmvaelqalsplvp...RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgil 153
                         k +t++ is+g       + l + v ++++ + +v    ++ +f+R+++qlg+g w++vdvS+d     +      +   + +++lpSg+l
  Bradi5g18717.2.p 412 vaKSSTIAEISTGvagsrdgALLLVSVEQYAVSTLHVHilyQKATFLRFCKQLGEGAWAVVDVSIDGLVVDQGlaaasTTANMNCRRLPSGCL 504
                       99*****************5444444455555554443346***********************985433332333447778999******** PP

                       EEEECTCE.EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 154 iepksngh.skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       ++++  ++ +kv wveh++++++++h l+rsl++sgla ga +w+atlqrqc++
  Bradi5g18717.2.p 505 VQQDTRNGfCKVKWVEHAEYDESSVHPLYRSLLRSGLALGAGRWLATLQRQCKC 558
                       *98877777*******************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-1899167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-20102168IPR009057Homeodomain-like
PROSITE profilePS5007116.973109169IPR001356Homeobox domain
SMARTSM003891.3E-16111173IPR001356Homeobox domain
CDDcd000862.03E-16112167No hitNo description
PfamPF000466.7E-17112167IPR001356Homeobox domain
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PROSITE profilePS5084838.35311561IPR002913START domain
SuperFamilySSF559613.3E-18314558No hitNo description
CDDcd088754.74E-93315556No hitNo description
SMARTSM002342.2E-25320558IPR002913START domain
PfamPF018522.6E-36321558IPR002913START domain
SuperFamilySSF559616.78E-18580810No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 818 aa     Download sequence    Send to blast
MPREKAMSFL GFSDDDGGDG ALTGMELPFP GAGTGVFIPT PALSVATADA AGHGGDGGRV  60
VPVGCAGGGT VRSASEAENE RRSRTIDHLD VVSGGGFGRD DDAACGMPRK RKRPYVRHSS  120
EQIQELQALF DKCPHPDEMQ RAELSRRLFL DPSQVKFWFQ NRRTQTKAKL VRDENVQLRQ  180
ENDRLRAENL CIREAMRHPV CGNCGRPVVL GVLSLEEQHL RAQNARLTEE LSRVCAASSE  240
FLGKSISLPA PLQTHQPEPM PGSRVQPAAG GVGSVPSTTV ASSTITEFTG TASTSSGTAI  300
MTMSEEPLEI AGIDKSVLLE LAKSAMDELV KMAQMEDPLW TPSVSLSDSP AKETLNYEEY  360
LNTFSPCIGV KPAGFQSEAS RESGIVISDD SVALVEALMD ERRWSNIFSC MVAKSSTIAE  420
ISTGVAGSRD GALLLVSVEQ YAVSTLHVHI LYQKATFLRF CKQLGEGAWA VVDVSIDGLV  480
VDQGLAAAST TANMNCRRLP SGCLVQQDTR NGFCKVKWVE HAEYDESSVH PLYRSLLRSG  540
LALGAGRWLA TLQRQCKCWA TLQSCVAAWE QYSSDVLAAG TQSLLKLAQR MMESFFSGVS  600
ASSALEWSKL DGFTDNIGND VRIIERKSVD EPGVPPGVVL CAATSVWMLV TPERLFQFLC  660
DEGTRAEWDI LSTGGPMQEV TNIAKGQQDG NTVSLLRTNT TNTQQNGILI LQETCTDASG  720
SMVVYAPVDI PAMHLVMSGG DSASVPLLPS GFVILPDGPT IPGDGHKTCG SLLTFAFQIL  780
VKNSEPTAKL TVESIQTVNN LISCTINRIK TALHCDV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107113PRKRKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581542.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLA0A0Q3KV810.0A0A0Q3KV81_BRADI; Uncharacterized protein
STRINGBRADI5G18717.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1